Projects of db.lofar.target.rug.nl

Total number of projects 397
Total number of users 615

Click on a project name to set the project.Only projects you are a member of are selectable.

The following project groupings are available:

Each DataProduct type has two columns. The first column gives the number of DataProducts that can be staged. The second column gives the number of public DataProducts.

ID Project Privileges Instrument Member of Member count Manager(s) Release DateBeamFormedCorrelatedPulsarImageUnspecified
405047 DDT9_001 2 LOFAR False 40 1 009720000000
405070 DDT9_002 2 LOFAR False 50 1 1913-11-250000000000
405021 LC9_001 2 LOFAR False 46 1 0000000000
405055 LC9_003 2 LOFAR False 39 1 0000000000
405045 LC9_004 2 LOFAR False 45 1 009720000000
405027 LC9_007 2 LOFAR False 40 1 0000000000
404997 LC9_009 2 LOFAR False 40 1 0000000000
404973 LC9_011 2 LOFAR False 46 1 0000000000
404967 LC9_014 2 LOFAR False 40 1 2018-12-12001458000004860
404965 LC9_015 2 LOFAR False 41 1 0038880000000
405013 LC9_016 2 LOFAR False 58 1 00322080000000
405034 LC9_017 2 LOFAR False 44 1 0028800000000
405007 LC9_018 2 LOFAR False 40 1 8000018000000
405065 LC9_019 2 LOFAR False 41 1 0000000000
404981 LC9_020 2 LOFAR False 44 1 002430000000
405032 LC9_021 2 LOFAR False 40 1 0000000000
405005 LC9_023 2 LOFAR False 42 1 0000771000000
405015 LC9_025 2 LOFAR False 38 1 00006000000
405061 LC9_026 2 LOFAR False 40 1 0000000000
404971 LC9_027 2 LOFAR False 45 1 0000000000
405053 LC9_028 2 LOFAR False 39 1 0000000000
404989 LC9_030 2 LOFAR False 59 1 0057360000000
405051 LC9_032 2 LOFAR False 39 1 0000000000
404993 LC9_035 2 LOFAR False 42 1 0000000000
405003 LC9_038 2 LOFAR False 39 1 160000000000
405030 LC9_041 2 LOFAR False 40 1 0000102000000
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JBRODERICKJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISTURRIZIANI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDMULCAHYDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESHORNEFFER
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNKSENDMALLOC
MANCINIMHDVANDERWIELMIDDELBERG
MOSSPIZZORAF93
RAINER_BECKRBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOUKLEINVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

CANDI-2

Radio observations of the planetary system Corot-7

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Spectral structure and particle acceleration in the hotspots of FR II radio sources

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AKAPPESALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMBRUEGGEN
MHDVANDERWIELMOSSPIZZO
PREETIKHARBRAF93RBOKHORST
RENTINGRSCHULZSARRVESH
SCHAAPSHULEVSKITORIBIO
TRUESTEDTVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNLMORABIT
MALLOCMANCINIMHDVANDERWIEL
MILEYMORABITOMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Deep Polarization Observations of the GOODS-N Field with LOFAR

Faraday tomography of the local ISM, around the area of 3C196 field

STUDY OF NON-MERGING MASSIVE CLUSTERS AT LOW FREQUENCY

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRETONRCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARIAM
MARIAMUTZMARISAGEYERMHDVANDERWIEL
MMTZMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGERGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Large-scale magnetic field connecting A399-A401

The particle content in the low-power FR I radio galaxy 3C 449

Probing the jet of blazar 3C 273

Confirmation and timing of pulsar candidates from a targeted LOFAR search towards PWNe and SNRs.

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CATERINA_TIBURZICERRIGONEDONKER
EORRUFRIESWIJKGEMMA
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MARIOMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINANTONIARARNOSCHOENMAKERS
ASTEWARTAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DARIOCARBONEDONKEREORRU
FENDERFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJBRODERICK
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISWINBANKTORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJEENRIQUEZJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Coordinated multi-frequency and in-situ study of Jupiter's radiation belt during Juno's prime mission

Exploring radio-loud AGN recurrent activity with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECOOPERDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKIMZAG
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP

A LOFAR survey for millisecond pulsars in unidentified Fermi gamma-ray sources

Tracking the passage of an Ultra Fast CME

ALWINARNOSCHOENMAKERSASTEWART
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJBRODERICKJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ABHIK777ALWINARNOSCHOENMAKERS
AWTIER0AWTIER2EORBEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREORRUFRIESWIJK
GERGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JELICJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSAROD
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

LBA observations of M51 and NGC891

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMCROSLE1MHDVANDERWIEL
MOSSOSTENPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Search of radio emission from the 55 Cnc exoplanetary system

Solar coronal mass ejections

Search for Star-Planet Magnetic Interaction in a Nearby Terrestrial Exoplanetary System

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BWSCERRIGONECSOBEY
DONKEREORRUFRIESWIJK
GOEIHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKIMZAGKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMICHILLIMOSS
PILIAPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISOBEY
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDIANAMOROSAN
DMOROSANDONKEREORRU
FKBREITLFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

LOFAR Long Baselines commissioning

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDOMINIKAHUNIKDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JAMROZYJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASWARWASYGRANGE
ZIEMKEZUCCAP
AWTIER0

Measuring magnetic fields in the Solar wind

The large-scale magnetic field of NGC 5775

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRETONRCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
AWTIER0

Monitoring Scintillation above LOFAR

ALWINANTONIARARNOSCHOENMAKERS
AVDHORSTAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREORRUFRIESWIJK
GOEIHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
RVWEERENSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR Localization of GBNCC Pulsar Survey Discoveries

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Targeted searches for pulsars and fast transients

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECOURTINDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JULIENGIRARDJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BENJAMINALCOCKBEUKEMABLAAUW
BRENTJENSCERRIGONECHRYSAPHI
CVOCKSDONKEREDUARD
EORRUFRIESWIJKGLESENER
GMANNGOEIHAMISHREID
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
KUZNETSOVAAMALLOCMANCINI
MELNIKMHDVANDERWIELMOSS
MYKOLAGOPBROWNINGPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TOMMURATTORIBIOVEEN
VERMAASVILMERYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBRIANDCERRIGONECTASSE
DONKEREORRUFRIESWIJK
GOEIGRIESSMEIERHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJULIENGIRARD
JURGESKLAZEMAKLIJN
LLAMYLLOINARDMALLOC
MANCINIMHDVANDERWIELMJANVIER
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZARKAZIEMKE
ZUCCAP

Triggered follow-up for AARTFAAC Transient Sources

Triggered follow-up of AARTFAAC Transient Sources

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREMILY
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJCONWAYJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNLCHOMIUKMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSBOURKE
SCHAAPSHULEVSKISTEPHEN_BOURKE
TORIBIOVARENIUSVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

test-lofar

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREJOS
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESJVRTILEKKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
RVWEERENSARRVESHSCHAAP
SGIACINTSHULEVSKISOMAK
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0

Exoplanet radio search and characterization

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JBRODERICKJCAMJJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
STURRIZIANITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Pulsar Timing with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Studying Pulsars and the Interstellar Medium using International LOFAR Stations

Cosmic ray propagation in two nearby spiral galaxies

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FDGFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ABILOUSABRAZENKOALISASHEVTSOVA
ALWINANOUTSOSARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBUBNOVCERRIGONE
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MAXIMMHDVANDERWIELMOSS
OULYANOVPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISKORYK_UA
TORIBIOVEENVERMAAS
VLADYERIN_SERGEYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Investigating Refraction Through the Solar Wind using Intensity and Phase Scintillation

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECOOPERDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKIMZAG
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PILIAPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BWSCBASSACERRIGONE
CHIATANCOOPERDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMICHILLIMOSS
PIZZORAF93RBOKHORST
RENTINGSANIDASSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BDABROWSKIBEUKEMABLAAUW
BRENTJENSCERRIGONECHYZY
DONKEREORRUFRIESWIJK
GOEIHEALDHMULDER
HOLTIESHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESJURUSIKKLAZEMA
KLIJNLESZEK_BLASZKIEWICZMALLOC
MANCINIMHDVANDERWIELMOSS
NALAPIZZORAF93
RAINER_BECKRBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VHEESENYGRANGEZIEMKE
ZUCCAP

The LOFAR EoR project

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Long-term proposal for solar observations with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR observations of the merging galaxy cluster Abell 2146

Cosmic Ray Air Showers

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHIATANDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JOERIJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONECSOBEY
DONKEREORRUFRIESWIJK
GEMMAGOEIGOLAM
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJORISVERBIESTJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

LOFAR Survey of High Mass star forming regions in Galactic plane

LOFAR surveys: Opening up a new window on the Universe

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE

Confirming the first LOFAR pulsar in a Supernova Remnant

Deep Observation of Possible Extended Emission Surrounding a Pulsar

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Continuing the LOFAR Tied-Array All-Sky Survey

Gravitational lenses at low frequencies

A joint LOFAR deep field: Elais-N1

Specular meteor echo observations with LOFAR International Stations

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSANIDAS
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZPLEUNISZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGLENNWHITEGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JONGREGSONJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
ROONKSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBMARCOTE
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
ISHWARJANRINZEJJDMOL
JKUENSEMJMOLDONJOSEP
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSERABMSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSASCAIFE
AWTIER0BEUKEMABLAAUW
BRENTJENSBRETONRCERRIGONE
DMULCAHYDONKEREORRU
FRIESWIJKGOEIHAVERKORN
HEALDHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASWREICHYGRANGE
ZIEMKEZUCCAP

Long Baseline Studies of High-redshift Radio Sources: Constraining particle acceleration and cold gas

AWTIER0

Location and motion of sources of Jupiter

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
KSENDMALLOCMANCINI
MHDVANDERWIELMIDDELBERGMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Pulsar Timing with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINANTONIARARNOSCHOENMAKERS
ASTEWARTAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREORRUFRIESWIJK
GOEIGOURDJIHMULDER
HOLTIESIACOBELLIJANRINZE
JBRODERICKJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Intergalactic shock-fronts and their relations to radio relics

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINAPOLATIDISARNOSCHOENMAKERS
ASGEKARAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREMIGEORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMARIAARIASDESAAMHDVANDERWIEL
MOSSPIZZOPSALAS
RAF93RBOKHORSTRENTING
ROONKRVWEERENSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECLARKEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
IWBJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FDGFRIESWIJKGOEI
HARWOODHMULDERHOLTIES
HORNEFFERIACOBELLIJANRINZE
JHARWOODJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Search for supernova remnants near magnetars

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Test project for ingesting to Poznan

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKERENRICORR
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJCONWAYJJDMOL
JKUENSEMJMARTIJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVARENIUS
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HFALCKEHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJULIENGIRARDJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZARKA
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISSTRAAL
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

CEP4 commissioning and characterisation

A deep and wide extragalactic survey at low frequencies...

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EDUARDEORRUFKBREITL
FRIESWIJKGALLAGPTGMANN
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARIOMARQUE
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Cosmic ray propagation in NGC 5055

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHIATANDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JORISVERBIESTJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP

FRATs: Commensal Real-Time Searches and localization of Fast Radio Burst

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGIATRINHGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SBUITINKSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Monitoring of Ionospheric Scintillation with LOFAR

LOFAR Galactic Radio Recombination Line Survey (LG-RRLS)

LOTAAS: The LOFAR Tied-Array All-Sky Survey for Pulsars and Fast Transients

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE

Low Frequency Observations of Jets from Young Stars in Taurus

A panchromatic search for advanced intelligence around nearby stars

Stellar Radio Astronomy with LOFAR

Triggered follow-up of AARTFAAC Transient Sources

MSSS HBA Survey

ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGODFREY
GOEIHARRIS42HMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJMOLDON
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMHVKMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOUELIPEN
VEENVERMAASWUCKNITZ
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABHAREBLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSOLAFSCHOLTENPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Measuring the energy of Saturns Magnetosphere

ALWINARNOSCHOENMAKERSASTEWART
AWTIER0AWTIER2EORBEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREORRUFRIESWIJK
GERGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPNBESTRAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Simultaneous extremely wide-bandwidth pulsar observations near Solar conjunction

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

MSSS

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KIMZAGKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASWUCKNITZ
YGRANGEZIEMKEZUCCAP

LOTAAS: the LOFAR Tied-Array All-Sky Survey

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Searching for MHz emission from brown dwarfs

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ABONAFEDEALWINARNOSCHOENMAKERS
ASCAIFEASTROEAWTIER0
BEUKEMABLAAUWBRENTJENS
BRUNETTI71CERRIGONECHIARA
CHYZYDONKEREORRU
FDGFRIESWIJKGEORGI
GMACARIOGOEIHMULDER
HOLTIESHORELLOUIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARNAUD
MBRUEGGENMHDVANDERWIELMHOEFT
MILEYMOSSPIZZO
RAF93RAFFERTYRBOKHORST
RCASSANORENTINGROONK
ROTTGERINGRUTAKRVWEEREN
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVALENTYN
VEENVERMAASWISE
YGRANGEZIEMKEZUCCAP

Studying Pulsars and the Interstellar Medium using International LOFAR Stations

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MAURAPILIAMHDVANDERWIELMOSS
PILIAPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Low Frequency Insights into the Radio Continuum - Star Formation Rate Relation

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0

Project for distributing public datasets for the LOFAR Data School

ALWINARNOSCHOENMAKERSAWTIER0
BENJAMINALCOCKBEUKEMABLAAUW
BRENTJENSCERRIGONECHRYSAPHI
CVOCKSDONKEREDUARD
EORRUFRIESWIJKGOEI
HAMISHREIDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MELNIKMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVILMERYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRIENZA2014CERRIGONEDONKER
EMIGEORRUFRIESWIJK
GODFREYGOEIHARWOOD
HMULDERHOLTIESIACOBELLI
JANRINZEJCROSTONJHARWOOD
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMORGANTI
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVHEESEN
YGRANGEZIEMKEZUCCAP

Particle acceleration and cold gas in high-redshift radio sources - long baseline and recombination line studies

ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
GOURDJIHMULDERHOLTIES
IACOBELLIJANRINZEJBRODERICK
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKERDRIESSEN
EORRUFRIESWIJKGOEI
HEALDHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JGELFANDJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MICHILLIMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SLANETORIBIOTTEMIM
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGER
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MEVIUSMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARODSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BWSCERRIGONECOOPER
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJORISVERBIESTJURGES
KIMZAGKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSMSERYLAKPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SOSLSOSLOWSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP

Pulsar Timing with LOFAR

Propagation of Electron Beams in the Solar Corona and Associated Type III Radio Emission as Seen by LOFAR

Shapiro delay and scintillation in a LOTAAS discovered binary millisecond pulsar

Testing the IC/CMB Model for X-ray Emission from Quasar Jets with LOFAR

LOBOS: the LOFAR LOng-Baseline calibratOr Survey

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFENDERFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJBRODERICK
JCAMJJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZOPJONKER
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Diffuse radio emission in Abell 2069 and the Corona Borealis Supercluster

Variable jet sources in the LOFAR band

ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR observations of the currently active transient XTE J1908+094

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHAVERKORN
HMULDERHOLTIESIACOBELLI
IPOLDERMANJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMORABITOMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
RVWEERENSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ABRACCOALWINARNOSCHOENMAKERS
AWTIER0AWTIER2EORBEUKEMA
BLAAUWBRENTJENSCERRIGONE
CVANECKDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MALVESMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVJELIC
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Density and temperature structure of NGC 7027 derived from optically thick radio spectrum

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKARAKOCKLAZEMA
KLIJNLLEVINMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGRLYNCHSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEYURIZIEMKE
ZUCCAP

High precision RMs from LOFAR observations of pulsars with parallax measurements, towards accurate reconstruction of the Galactic magnetic field

Finishing Cygnus: a new perpspective on the dense, cold gas in the Milky Way

Characterizing Galactic MHD turbulence with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGLENNWHITEGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARIAARIASDESAA
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
YMAAN4ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALBERTALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRUNETTI71CERRIGONE
CHYZYDONKEREORRU
FRIESWIJKGLENNWHITEGOEI
HAVERKORNHEALDHMULDER
HOLTIESHUIBINTEMAIACOBELLI
JANRINZEJCONWAYJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MCKEANMHDVANDERWIELMJH
MORABITOMORGANTIMOSS
NJJPIZZORAF93
RAFFERTYRBOKHORSTRENTING
RVWEERENSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASWILLIAMS
WISEYGRANGEZIEMKE
ZUCCAP
ADEBAHRALWINANDERSON
ARNOSCHOENMAKERSASCAIFEAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDMULCAHYDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
HORNEFFERIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RAINER_BECK
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Radio sources in outer corona and radio wave propoagation in the corona

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Low Frequency Investigation of the Super-CLASS Super-cluster

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJAMROZY
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSMSOIDAPAJDOSZ
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASWARWAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHYZYDONKER
EAKADAMSEORRUFRIESWIJK
GOEIHEALDHMULDER
HOLTIESHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RAINER_BECKRBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VHEESENYGRANGEZIEMKE
ZUCCAP

Following-up the first ever detected accretion burst in a high-mass YSO

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONECHIATAN
COOPERDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Extended radio continuum halo in the edge-on galaxy NGC5907

Low-frequency follow-up of transient triggers

FRATs: Commensal Real-Time Searches and Localization of Fast Radio Transients

2017LOFAROBS

Radio detection of cosmic ray air shower

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDIANAMOROSAN
DONKEREDUARDEORRU
FRIESWIJKGMANNGOEI
HAMISHREIDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNKRUPARMAKSIMOVIC
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVILMER
YGRANGEZIEMKEZUCCAP

Determining the properties of the first millisecond pulsar discovered by LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MKUIACKMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Hexacopter measurements

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECSOBEYDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EDWIN128EORRUERETANA
FENDERFRIESWIJKGER
GOEIHMULDERHOLTIES
HORNEFFERIACOBELLIJANRINZE
JELICJJDMOLJKUENSEM
JSMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
PNBESTRAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ABONAFEDEALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDDALLACA
DONKEREORRUFEDERICASAVINI
FRANCO_VAZZAFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMBRUEGGEN
MHDVANDERWIELMOSSNICOLAL
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Pulsar Timing with LOFAR

Mapping the Orion molecular cloud complex with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGER
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Radio emission from coronal shock waves and nascent CMEs

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
OLAFSCHOLTENPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SBUITINKSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Monitoring Scintillation above LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABIRZANBLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGEORGI
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MBRUEGGENMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
AWTIER0
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Measuring the energy of Saturn's lightning

AWTIER0

HOLOG_WINDMILL_TESTS

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

BLAZAR MONITORING WITH LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHAVERKORN
HMULDERHOLTIESIACOBELLI
JANRINZEJELICJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
WREICHYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

The LOFAR EoR project

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGALLAGPTGER
GOEIHARISHHMULDER
HOLTIESIACOBELLIJANRINZE
JELICJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARIO
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Solar activity studies with LOFAR

Continuing high-resolution 3d VLBI of a scattering-induced echo in B1508

ALWINARNOSCHOENMAKERSARP
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESHORNEFFER
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFRIESWIJKGMANN
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARIOMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Exploring the Hubble Frontier Fields with LOFAR

AKAPPESALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
RSCHULZSARRVESHSCHAAP
SHULEVSKITORIBIOTRUESTEDT
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

A Search for Radio Emissions from Extrasolar Planets on Highly Eccentric Orbits Near Planetary Periastron

The LOFAR Two-metre Sky Survey (LoTSS): Opening up a new window on the Universe

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Faraday Screen in front of a jet in the nearby spiral galaxy NGC4258

Blazar monitoring with LOFAR

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHFALCKE
HMULDERHOLTIESHORNEFFER
HOUBENIACOBELLIJANRINZE
JEENRIQUEZJJDMOLJKUENSEM
JPRACHENJURGESKLAZEMA
KLIJNLSPITLERMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINANNANELLESARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZOPSCHELLA
RAF93RBOKHORSTRENTING
SARRVESHSBUITINKSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Measuring the energy of Saturn's lightning

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGEORGIGOEI
HEALDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJONGREGSONJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISWINBANKTORIBIO
VEENVERMAASWARWAS
WISEYGRANGEZIEMKE
ZUCCAP
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRIENZA2014CERRIGONE
DONKEREMIGEORRU
FRIESWIJKGODFREYGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MMURGIAMORGANTIMOSS
NAIMROPIZZORAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TORIBIOTORRESVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Millisecond Pulsar Scintillation: a Pilot Study

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECSOBEYDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJOERIJORISVERBIEST
JURGESKIMZAGKLAZEMA
KLIJNMALLOCMANCINI
MARISAGEYERMHDVANDERWIELMICHILLI
MOSSMSERYLAKPILIA
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

MSSS LBA 2014

INVESTIGATING THE ACCRETION STATE OF THE MISSING LINK PULSAR J1023+0038

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Lightning Mapping with LOFAR

CMB-Quenching of High-z Blazars

LOFAR studies of the evolution of coronal mass ejections in the heliosphere

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFRIESWIJKGMANN
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

sun activity

Radio emission from coronal shock waves

Exoplanet radio search and characterization

Test of optimal strategy for exoplanet detection with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECTASSEDONKER
EORRUFRIESWIJKGOEI
HAMISHREIDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARQUEMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

The LOFAR Quiescent Sun

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJAMROZY
JANRINZEJJDMOLJKUENSEM
JLARSSONJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
RUPAKROYSARRVESHSCHAAP
SHULEVSKISUMANATORIBIO
VEENVERMAASWARWAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
ROTTGERINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDJONESDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALBERTALWINAMUELLER
ANDERSONANNAARNOSCHOENMAKERS
AWTIER0BEUKEMABIRZAN
BLAAUWBRENTJENSCERRIGONE
CHIARACTASSEDCSEH
DONKERDSCHWARZEORRU
FDGFRIESWIJKGLENNWHITE
GMACARIOGOEIHEALD
HMULDERHOLTIESHORELLOU
IACOBELLIISABELLAPRANDONIIVBEMMEL
JAMROZYJANRINZEJJDMOL
JKUENSEMJSMJURGES
KLAZEMAKLIJNMAHONY
MALLOCMANCINIMBRUEGGEN
MCKEANMERLONI1972MHDVANDERWIEL
MJHMOSSPIZZO
PJFPNBESTRAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
SMANDALSMCGEETORIBIO
VEENVERMAASWILLIAMS
YGRANGEZIEMKEZUCCAP

Radio Structures in a Newly-Discovered Early-Stage Major Merger

Precision Measurements of Cosmic Rays with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDIANAMOROSAN
DONKEREORRUFKBREITL
FRIESWIJKGMANNGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKERDRAONKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARIOMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Exploring radio-loud AGN recurrent activity with LOFAR: Part Two

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JEGPEEKJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Resolving the small scale structure of 'young' radio sources at low frequencies: Dying young and frustrated?

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Cosmic Ray Air Showers

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDFALCETADONKER
EORRUFBOULANGFERRIERE
FRIESWIJKGOEIHAVERKORN
HMULDERHOLTIESIACOBELLI
JANRINZEJELICJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMALVES
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDCSEH
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
ROCCOCSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASWILLIAMSYGRANGE
ZIEMKEZUCCAP

LOFAR surveys: Opening up a new window on the Universe

2013LOFAROBS

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0

Wide field searches for image-plane radio transients

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR timing of pulsars and rotating radio transients discovered in GBT 350-MHz surveys

The LOFAR Two-metre Sky Survey: Opening up a new window on the Universe

Blazar-Jet Kinetic Power from Low-Frequency Radio Observations

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR imaging of the first GRG discovered by MSSS

ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
IVANMARTIVIDALJANRINZEJCONWAY
JJDMOLJKUENSEMJMARTI
JMOLDONJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSNAIMRO
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOTORRES
VARENIUSVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECSOBEYDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RAINER_BECKRBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SOBEYTORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AJSG3ALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MKARGOMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SKOENIG83STEPHEN_BOURKETORIBIO
VARENIUSVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Angular and temporal scatter broadening of pulsars

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVANECKDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
SSAFIHARBTJAFFETORIBIO
VEENVERMAASWESTJL
YGRANGEZIEMKEZUCCAP
AWTIER0
AFROMEROALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECJNAUDET
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
PRIESRAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISVANCETORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABIAGIOFORTEBLAAUW
BRENTJENSCERRIGONECVOCKS
DONKEREORRUFRIESWIJK
GALLAGPTGMANNGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Blazar-Jet Kinetic Power from Low-Frequency Radio Observations

Observation of a giant radio brightest cluster galaxy

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECORDESDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKIMZAGKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
RYANMSHANNONSARRVESHSCHAAP
SHAMICHATTERJEESHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Starting the LOFAR LBA Survey

AWTIER0HTTP_OPERSCHAAP
YGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABIAGIOFORTEBLAAUW
BRENTJENSCERRIGONECVOCKS
DONKEREORRUFRIESWIJK
GALLAGPTGMANNGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARIO
MHDVANDERWIELMOSSPIZZO
POZOGARAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ADELLERALWINAPOLATIDIS
ARNOSCHOENMAKERSAWTIER0AZENSUS
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JCONWAYJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMCKEAN
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VTUDOSEWUCKNITZYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Carbon radio recombination lines in 3C190

TESTpostNETRECONFIG

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECTASSEDONKER
DSANTOSCOSTAEORRUFRIESWIJK
GCLARK0630GOEIHAJIMEKITA
HMULDERHOLTIESH_MISAWA_330
IACOBELLIJANRINZEJJDMOL
JKUENSEMJULIENGIRARDJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOTSUCHIYA0925
VEENVERMAASYGRANGE
ZARKAZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CATERINA_TIBURZICERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP

A New Route to High-Redshifts?

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAVDHORST
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJBRODERICKJCAMJ
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMJH
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISTURRIZIANI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRIENZA2014CERRIGONEDONKER
EORRUFRIESWIJKGEORGI
GODFREYGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMMURGIA
MORGANTIMOSSNYLAND
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVILCHEZYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREMIG
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGROSPA
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

The LOFAR EoR project

ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
GOURDJIHMULDERHOLTIES
IACOBELLIJANRINZEJBRODERICK
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Commissioning follow-up of a ToO

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMCCOLMLMHDVANDERWIEL
MOSSNORDENPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
WIJNHOLDSYGRANGEZIEMKE
ZUCCAP
ABONAFEDEALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
DRABENTEORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMHOEFTMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

The First LOFAR Survey of Distant Galaxy Clusters

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESIACOBELLI
JANRINZEJBRODERICKJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGRVWEEREN
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
WUCKNITZYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BASTIAANBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
DUSCHAEORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKIM
KLAZEMAKLIJNLTATEST
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASWISE
WJVRIENDYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAROFFRINGA
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFLOMERTENSFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MEVIUSMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINAPOLATIDISARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
DONKEREORRUFENDER
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARCHIBALDARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
STINEBRINGTORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABIAGIOFORTEBLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDIANAMOROSAN
DONKERECARLEYEDUARD
EORRUFKBREITLFRIESWIJK
GALLAGPTGMANNGOEI
HAMISHREIDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARQUEMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FDGFRIESWIJKGOEI
GRIESSMEIERHMULDERHOLTIES
IACOBELLIJANRINZEJBRODERICK
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNKOKICHAU
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHIMWELL
SHULEVSKITOBIASWINCHENTORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECOURTINDONKER
DSANTOSCOSTAEORRUFRIESWIJK
GAUTIERGOEIHERSANT
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JULIENGIRARDJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMHOFSTADTERMOSS
NADINENPIZZORAF93
RBOKHORSTRENTINGRFENDER
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZARKAZIEMKE
ZUCCAP

Low-frequency follow-up of transient triggers

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMORABITO
MOSSPIZZORAF93
RBOKHORSTRENTINGROONK
RVWEERENSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Targeted Searches for Pulsars and Fast Transients

Imaging the Pulsars in Globular Cluster M13

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDANIELWDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJHARTMANJJDMOL
JKUENSEMJLAZIOJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZARKAZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREOGORMA2014
EORRUFRIESWIJKGOEI
HANSOLOFHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SORAMSTORIBIOVARENIUS
VEENVERMAASWVLEMMINGS
YGRANGEZIEMKEZUCCAP

LC0_019

Magnetizing the universe with dwarf galaxies

ALWINARNOSCHOENMAKERSAS595
ASCAIFEAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MBIRKINSHAWMBROWNMHDVANDERWIEL
MOSSMRBELLNJJ
PADDYLEAHYPIZZORAF93
RBATTYERBESWICKRBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITENSSLINTOM_MUXLOW
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JEISLOEFFELJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Monitoring Scintillation above LOFAR

A directed search for (high-velocity) pulsars in known supernova remnants and pulsar wind nebulea

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREMIG
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZOPSALAS
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JMOLDONJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMORABITOMOSS
PIZZORAF93RBOKHORST
RENTINGROONKSARRVESH
SCHAAPSHULEVSKISWEIJEN
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

The mysterious giant radio source 0917+75

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

A low-frequency survey for extrasolar auroral emission

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Low-frequency follow-up of transient triggers

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJMAO
JURGESKAASTRAKLAZEMA
KLIJNLIYIGMALLOC
MANCINIMERNIERMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASWARWAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONEDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZPLEUNIS
ZUCCAP
AWTIER0
ALWINANDERSONARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
IMKEDEPATERJANRINZEJJDMOL
JKUENSEMJULIENGIRARDJURGES
KLAZEMAKLIJNLLAMY
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGRIABOV
SARRVESHSCHAAPSEB_HESS
SHULEVSKITORIBIOVEEN
VERMAASWANGJWUCKNITZ
YGRANGEZARKAZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JULIENGIRARDJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZARKAZIEMKE
ZUCCAP

Energetic electrons generated in solar flares

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKEFLAVICHKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Characterizing the broadband spectrum of the repeating Fast Radio Burst 121102 using simultaneous Arecibo and LOFAR observations

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMARIOMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

The 2015 V404 Cyg outburst: further monitoring with LOFAR

Radio sky monitor: a pilot study with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

A low-frequency study of the bright pulsar B1237+25

Long Baseline Studies of High-redshift Radio Sources: Constraining particle acceleration and cold gas

Pulsars2

Simultaneous extremely wide-bandwidth pulsar observations near Solar conjunction

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FDGFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJELICJJDMOL
JKUENSEMJSMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPNBESTRAF93
RBOKHORSTRENTINGROCCOC
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASWILLIAMSYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JORISVERBIESTJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSMSERYLAK
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISOSLTORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Mapping the spectral turnover of the Luminous Infrared Galaxy Arp 299

ALWINAMESFOORTARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP

Atomic hydrogen at z>5

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMCKEANMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Continued LOFAR Timing of Discoveries from the GBNCC Pulsar Survey

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Fine structures in solar radio emission

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFRIESWIJKGMANN
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARIOMARQUE
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Ultra steep spectrum giant radio galaxy with recurrent radio jet activity

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Joint LOFAR and Effelsberg Observations to Localise a Repeating Fast Radio Burst

ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JMOLDONJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMILEYMORABITO
MORGANTIMOSSPIZZO
RAF93RBOKHORSTRENTING
ROONKRVWEERENSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Measuring the energy of Saturn's lightning

2014LOFAROBS

Search for possible pulsar located at SNR CTA-1

ALWINARNOSCHOENMAKERSAROFFRINGA
AWTIER0AWTIER2EORBENEDETTA_CIARDI
BERNARDIBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EDWIN128EORRUERETANA
FRIESWIJKGARRELTMGER
GERAINTGOEIHARISH
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARTINEZ
MHDVANDERWIELMOSSPIZZO
PLABROPRAF93RAJAT
RBOKHORSTRENTINGSALEEM
SANAZ_KAZEMISARRVESHSCHAAP
SCHAYESHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

The low-frequency structure and jet kinetic power of 1222+216

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASWUCKNITZYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJACCOVINK
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARIAARIASDESAA
MHDVANDERWIELMOSSPINGZHOU
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ABONAFEDEAGWILBERALWIN
ARNOSCHOENMAKERSAWTIER0BEUKEMA
BLAAUWBOTTEONBRENTJENS
BRUNETTI71CERRIGONEDONKER
EORRUFMASSAROFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RAFFERTYRBOKHORST
RCASSANORENTINGROTTGERING
RVWEERENSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
TVENTURIVEENVERMAAS
VIRGINIA_77YGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSASTROJAKE
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
GRIESSMEIERHMULDERHOLTIES
IACOBELLIIVASYLIEVAJANRINZE
JJDMOLJKUENSEMJNICHOLS
JULIENGIRARDJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOTURNERVEEN
VERMAASWMAJIDYGRANGE
ZARKAZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBMARCOTE
BRENTJENSCBASSACERRIGONE
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKEIMPEMA
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHAMICHATTERJEESHULEVSKITORIBIO
VEENVERMAASXIGGYSTARDUST
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BASSABEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SANIDASSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZPLEUNISZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MKUIACKMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

The Unexplained Pressure in the Closest Cold ISM

AJSG3ALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDIANAMOROSAN
DONKEREORRUFRIESWIJK
GALLAGPTGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINAMRUTAARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
CHIATANCOOPERDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJOERIJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMICHILLI
MOSSPIZZORAF93
RBOKHORSTRENTINGSANIDAS
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JEENRIQUEZJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGROCCOC
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

AGN outburst in MS0735.6+7421

A joint LOFAR deep field (Elais)

ABILOUSALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
DONKEREORRUFRIESWIJK
GOEIHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KIMZAGKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MICHILLIMOSSPILIA
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITOMHASSALLTORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFKBREITLFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMAGDALENIC
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Lightning Imaging with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKERDSANTOSCOSTA
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
IMKEDEPATERJANRINZEJJDMOL
JKUENSEMJULIENGIRARDJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZARKA
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Probing the Jets of Blazars 3C 273 and 3C 454.3

ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDCSEH
DONKERDRABENTEORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JCONWAYJJDMOLJKUENSEM
JMOLDONJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMORABITOMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVARENIUS
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBMARCOTE
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJBRODERICKJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Energetic electron propagation in solar flares

ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MORABITOMORGANTIMOSS
NJJ1PIZZORAF93
RBOKHORSTRENTINGROONK
ROTTGERINGSARRVESHSCHAAP
SHULEVSKITIELENSTORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRUNETTI71CERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMBRUEGGEN
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
RVWEERENSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Extragalactic Radio Recombination Lines: An LTA resource project

Probing pulsar magnetospheres at 10-90 MHz with LOFAR (Part II)

ALWINARNOSCHOENMAKERSASTROTWJ
AWTIER0BEUKEMABLAAUW
BOTTEONBRENTJENSBRUNETTI71
CERRIGONEDONKEREORRU
FDGFRIESWIJKGOEI
HMULDERHOLTIESHUIBINTEMA
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
RVWEERENSARRVESHSCHAAP
SHIMWELLSHULEVSKISMANDAL
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Directors Discretionary time - Radio Recombination Lines Cas A

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOHNQUINN
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOONEYSEMORABITOMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AARTHIABONAFEDEALWIN
ANNANELLESARNOSCHOENMAKERSASTEWART
ASTROEAVDHORSTAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECJRISELEYCLARKE
DJONESDMULCAHYDONKER
EORRUFDGFRIESWIJK
GEORGIGOEIHEALD
HMULDERHOLTIESHORNEFFER
IACOBELLIJAMIEFARNESJANRINZE
JBRAYJBRODERICKJEENRIQUEZ
JJDMOLJKUENSEMJONGREGSON
JURGESJURUSIKKLAZEMA
KLIJNKSENDMALLOC
MAMTAPMANCINIMHDVANDERWIEL
MJHMOSSPIZZO
PSCHELLARAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISWINBANKTORIBIO
TRUESTEDTVEENVERMAAS
VHEESENVVACCAWARWAS
WILLIAMSYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR surveys: Opening up a new window on the Universe

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREMIG
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZOPSALAS
RAF93RBOKHORSTRENTING
ROONKROTTGERINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGLENNWHITEGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
LMORABITMALLOCMANCINI
MHDVANDERWIELMILEYMORABITO
MOSSPIZZORAF93
RBOKHORSTRENTINGSALGADO
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOANGHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGROTTGERING
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
GOURDJIHMULDERHOLTIES
IACOBELLIJANRINZEJBRODERICK
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDMULCAHYDONKER
EORRUFRIESWIJKGOEI
HAYDEN_RAMPADARATHHMULDERHOLTIES
IACOBELLIJANRINZEJCONWAY
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMBIETENHOLZMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VARENIUSVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Joint LOFAR-LWA observations of pulsars at low ecliptic latitudes

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMCKEANMHDVANDERWIEL
MOSSNJJPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
WUCKNITZYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HFALCKEHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJULIENGIRARDJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASWMAJIDYGRANGE
ZIEMKEZUCCAP
ADEBAHRALWINARNOSCHOENMAKERS
ARPAWTIER0BEUKEMA
BLAAUWBRENTJENSBRUNETTI71
CERRIGONECHYZYCVANECK
DBOMANSDONKEREORRU
FRIESWIJKGOEIHAVERKORN
HEALDHMULDERHOLTIES
HORNEFFERIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNKSEND
MALLOCMANCINIMHDVANDERWIEL
MIDDELBERGMOSSPIZZO
RAF93RAINER_BECKRBOKHORST
RENTINGRJDETTMARSARRVESH
SCHAAPSHULEVSKITORIBIO
UKLEINVEENVERMAAS
WREICHYGRANGEZIEMKE
ZUCCAP

Using LOFAR for detailed studies of AGN, and AGN physics

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITCANTWELLTORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EDUARDEORRUFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMAGDALENIC
MALLOCMANCINIMARIO
MARQUEMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AKRANKOWSKIALWINARNOSCHOENMAKERS
AWTIER0BDABROWSKIBEUKEMA
BLAAUWBRENTJENSCERRIGONE
CVOCKSDIANAMOROSANDONKER
EDUARDEORRUFKBREITL
FRIESWIJKGMANNGOEI
HAMISHREIDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

High-resolution 3d VLBI of a scattering-induced echo in B1508+55

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

None

Monitoring Ionospheric Scintillation above LOFAR

Cygnus loop: probing the two remnant scenario

AGUAPLANOAKAPPESALWIN
ARNOSCHOENMAKERSAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREORRUFRIESWIJK
GHISELLINIGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMBRUEGGENMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SBARRATOSCHAAPSHULEVSKI
TORIBIOTRUESTEDTVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

First look at radio recombination lines in AGN

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHYZYDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JSKJURGESKLAZEMA
KLIJNKRANKOWSKIKROZKO
LESZEK_BLASZKIEWICZMALLOCMANCINI
MCURYLOMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASWLEWANDOWSKI
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOHNQUINN
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOONEYSEMORABITOMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRAMSAY
HMULDERHOLTIESIACOBELLI
JANRINZEJEENRIQUEZJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Quiet Sun studies with LOFAR

AAYUSHSAXENAADELLERADRABENT
ALBERTALWINANTONIAR
APMECHEVARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECTASSEDONKER
DRABENTEDWIN128EORRU
FRIESWIJKGOEIHMULDER
HOANGHOLTIESHUIBINTEMA
IACOBELLIJANRINZEJJDMOL
JKUENSEMJSMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMCTARRMHDVANDERWIEL
MHOEFTMIKE_HOGANMLHUANG
MORABITOMOSSNJJ
NYLANDPIZZOPNBEST
RAF93RAFFERTYRBOKHORST
RENTINGROTTGERINGRVWEEREN
SARRVESHSCHAAPSHIMWELL
SHULEVSKISMANDALSTEPHEN_BOURKE
TORIBIOVEENVERMAAS
VIKRAMRADHAKRISHNANWILLIAMSYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECTASSEDONKER
EORRUFRIESWIJKGOEI
GRIESSMEIERHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJULIENGIRARDJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZARKA
ZIEMKEZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MIXKLIMMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJMAO
JURGESKLAZEMAKLIJN
LIYIGMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMARISAGEYERMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

A Quest for the Radio Cosmic Web

Solar noise storms in the decametric and metric range: a study with LOFAR and the Nançay Radioheliograph

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFKBREITLFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

LOFAR Observation of Eclipsing Binary Pulsars

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JBRODERICKJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MJHMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
STURRIZIANITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSBUITINK
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ABONAFEDEABONAFEDE_2ALWIN
ARNOSCHOENMAKERSASCAIFEASTROE
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECLARKE
DONKERDRABENTEORRU
FDGFRIESWIJKGEORGI
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MBRUEGGENMHDVANDERWIELMHOEFT
MOSSPIZZORAF93
RBOKHORSTRENTINGRUTAK
RVWEERENSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASWISE
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASWUCKNITZ
YGRANGEZIEMKEZUCCAP
ABONAFEDEALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRUNETTI71CERRIGONE
DONKEREORRUFDG
FEDERICASAVINIFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMBRUEGGEN
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRCASSANO
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASVIRGINIA_77
WISEYGRANGEZIEMKE
ZUCCAP

A search for p-H2CO, a potential EoR contaminant, toward the Galactic Center, W43, W44, W49, and M82

ALWINANTONIARARNOSCHOENMAKERS
ASTEWARTAWTIER0BEUKEMA
BLAAUWBRENTJENSBWS
CERRIGONECTASSEDONKER
EORRUFENDERFRIESWIJK
GOEIGOURDJIHMULDER
HOLTIESIACOBELLIJANRINZE
JBRODERICKJJDMOLJKUENSEM
JNICHOLSJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMJHMOSS
PIZZOPJONKERRAF93
RBOKHORSTRENTINGROONK
RWIJERSSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREDWIN128
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZOPSALAS
RAF93RBOKHORSTRENTING
ROONKSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Probing a Coronal Mass Ejection with Scintillation Arcs

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JEISLOEFFELJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSCAMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ADELLERALWINARCHIBALD
ARNOSCHOENMAKERSAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREORRUFRIESWIJK
GOEIHEALDHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JORISVERBIESTJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSMSERYLAK
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ABURGASSERAHMJTRIAUDALWIN
ARNOSCHOENMAKERSARTEMBURDANOVAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDIDIERPQUELOZDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJDEWITJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMICHAELGILLONMKNAPP
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VALERIEVANGROOTELVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MILEYMORABITOMOSS
PIZZORAF93RBOKHORST
RENTINGROONKRVWEEREN
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSASGEKAR
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
CSOBEYDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJOERIJORISVERBIEST
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MICHILLIMOSSMSERYLAK
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGLENNWHITEGOEI
HAVERKORNHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJONGREGSONJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGROONKRVWEEREN
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Time-domain follow up of steep spectrum pulsar candidates

Towards the physical properties of Faraday filaments

The low-frequency emission of the persistent source associated with FRB 121102

AWTIER0

Nearby Galaxies in LoTSS

A Search for radio emissions from HD 80606b near planetary periastron

AWTIER0
AWTIER0

Finishing the LOFAR LBA HETDEX survey

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

PS86X1-Interplanetary CubeSat and Thin-Film Spacecraft/Lander/Rover Communications and Navigation Pathfinder Experiment with LOFAR and the LuxSpace 4M Lunar Flyby Mission

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MKUIACKMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Continued LOFAR Gridding/Timing of Discoveries from the GBNCC Pulsar Survey

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BDABROWSKIBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
KRANKOWSKILESZEK_BLASZKIEWICZMALLOC
MANCINIMHAJDUKMHDVANDERWIEL
MOSSNJJPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AKRANKOWSKIALWINARNOSCHOENMAKERS
AWTIER0BDABROWSKIBEUKEMA
BLAAUWBMATYJASIAKBRENTJENS
CERRIGONECVOCKSDIANAMOROSAN
DONKEREORRUFRIESWIJK
GALLAGPTGMANNGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKACPERKOTULAKKLAZEMA
KLIJNLESZEK_BLASZKIEWICZMAGDALENIC
MALLOCMANCINIMHAJDUK
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
RUDAWYRYANA38SARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
YOSSZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BDABROWSKIBEUKEMABLAAUW
BRENTJENSCERRIGONECVOCKS
DONKEREORRUFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KACPERKOTULAKKLAZEMAKLIJN
KRANKOWSKILESZEK_BLASZKIEWICZMALLOC
MANCINIMHAJDUKMHDVANDERWIEL
MKUIACKMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEYOSSZIEMKE
ZUCCAP

Search for OH Maser Emission at 54 MHz in Galactic Star-forming Regions and Supernova Remnants

Radio sky monitor: a pilot study with LOFAR

Searching for pulsars and RRATs in nearby galaxies M33, M81 & M82

Radio observations of the planetary system Tau Bootes

AWTIER0

Mapping spectral turnovers in Arp 220 as a test-case for low-frequency studies of local (U)LIRGs

ALWINANOUTSOSARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JOERIJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SOBEYTORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Detection and characterization of the lunar ionosphere

LEA032

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0

PSRJ2032+4127 towards Periastron

Long Baseline Studies of High-redshift Radio Sources: Constraining particle acceleration and cold gas

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Probing the Stellar Flare-Coronal Mass Ejection Relationship

AWTIER0

A joint LOFAR deep field: Elais-N1

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFKBREITLFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMARIOMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MHVKMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOUELIPENVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Characterizing the shells of Jupiter's icy moons using reflected Jovian Decametric Emission

A LOFAR survey of low Dispersion measure pulsars to study frequency evolution of scatter broadening

ALWINARNOSCHOENMAKERSAWTIER0
BENBURNINGHAMBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MJHMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSASCAIFE
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Delving Deeper into the Mystery of Pulsar Mode Switching

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRUNETTI71CERRIGONEDONKER
EORRUFDGFRIESWIJK
GDIGENNAROGOEIHMULDER
HOLTIESHUIBINTEMAIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGRVWEEREN
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE

The first MHz observations of an ultra cool dwarf star

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ABONAFEDEALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BOTTEONBRENTJENSBRUNETTI71
CERRIGONEDONKEREORRU
FDGFEDERICASAVINIFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MBRUEGGENMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RCASSANORENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVEENVERMAAS
VIRGINIA_77YGRANGEZIEMKE
ZUCCAP

The LOFAR survey of the Virgo cluster

Probing the Effects of Aging in Scaling Relations between Jet Power and Radio Power

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVANECKDONKER
EORRUFBOULANGFERRIERE
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JELICJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMALVESMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZOPRIVONG
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREMIG
EORRUFRIESWIJKGLENNWHITE
GOEIHMULDERHOLTIES
IACOBELLIJACCOVINKJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TIELENSTORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHIATANCOOPER
DONKEREORRUFRIESWIJK
GOEIHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABIRZAN
BLAAUWBRENTJENSBRIENZA2014
CAROCERRIGONEDONKER
EMIGEORRUFDG
FRIESWIJKGODFREYGOEI
HARWOODHFALCKEHMULDER
HOLTIESIACOBELLIJAMROZY
JANRINZEJCONWAYJCROSTON
JHARWOODJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MILEYMJHMORGANTI
MOSSPIZZOPNBEST
RAF93RAFFERTYRBOKHORST
RENTINGROONKROTTGERING
SARRVESHSCHAAPSHULEVSKI
TCANTWELLTORIBIOVEEN
VERMAASVHEESENVILCHEZ
WISEYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
KOKICHAUMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

STUDY OF NON-MERGING MASSIVE CLUSTERS AT LOW FREQUENCY

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJAMROZY
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGRUPAKROY
SARRVESHSCHAAPSHIMWELL
SHULEVSKISUMANATORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

LOFAR Legacy 60 MHz survey of the 3CRR catalogue

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BASSABEUKEMABLAAUW
BRENTJENSBWSCBASSA
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
LSPITLERMALLOCMANCINI
MHDVANDERWIELMICHILLIMOSS
PIZZORAF93RBOKHORST
RENTINGSANIDASSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP

Large-scale CRRL emission in high mass starforming regions

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDANIELWDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JLAZIOJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMKNAPPMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECJMADONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMCNAMARA
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
WISEYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHARISH
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
LVEKOOPMANSMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JOERIJURGESKIMZAG
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PILIAPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP

LOFAR observations of the partial solar eclipse on 20 March 2015

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Determining the properties of the fastest-spinning Galactic field millisecond pulsar

ADELLERALWINAPOLATIDIS
ARNOSCHOENMAKERSASTROEAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONECVOCKS
DONKEREORRUFKBREITL
FRIESWIJKGOEIHMULDER
HOLTIESHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARTINEZ
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TOBIACTORIBIOVEEN
VERMAASWUCKNITZYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOANGHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JOYDEEPJURGESKLAZEMA
KLIJNMALLOCMANCINI
MD27MHDVANDERWIELMOSS
PIZZOPRATIKD13RAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Demonstration of Space Weather Monitoring with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Interferometric imaging observations of the Sun with LOFAR

Variable jet sources in the LOFAR band

ADEBAHRALWINANDERSON
ARNOSCHOENMAKERSAWTIER0BEUKEMA
BLAAUWBLEXBRENTJENS
CERRIGONECHYZYCVANECK
DJONESDMULCAHYDONKER
EMIGEORRUFRIESWIJK
GOEIHAVERKORNHEALD
HMULDERHOLTIESHORNEFFER
IACOBELLIJANRINZEJCONWAY
JJDMOLJKUENSEMJURGES
JURUSIKKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MIDDELBERGMOSSPALADINO
PIZZORAF93RAINER_BECK
RBOKHORSTRENTINGRFENDER
RJDETTMARROONKROTTGERING
SARRVESHSCHAAPSHULEVSKI
TORIBIOUKLEINURB
VEENVERMAASVHEESEN
WARWASYGRANGEZIEMKE
ZUCCAP

A misaligned DDRG with double peak emission lines

AKONOVALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HFALCKEHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJNICHOLSJULIENGIRARD
JURGESKLAZEMAKLIJN
LECAVELILLAMYMALLOC
MANCINIMHDVANDERWIELMOSS
NOISYSKYPIZZORAF93
RBOKHORSTRENTINGRFENDER
RIABOVSARRVESHSCHAAP
SEB_HESSSHULEVSKISOOBASH
TORIBIOVEENVERMAAS
WMAJIDYGRANGEZARKA
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

VLBI Investigations of a Protostellar Jet with LOFAR

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHFALCKE
HMULDERHOLTIESIACOBELLI
JANRINZEJEENRIQUEZJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINANOUTSOSARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRETONRBWS
CERRIGONECHIATANCOOPER
DONKEREORRUFRIESWIJK
GOEIGRIESSMEIERHESSELS
HMULDERHOLTIESIACOBELLI
JANRINZEJDONNERJJDMOL
JKUENSEMJORISVERBIESTJURGES
KLAZEMAKLIJNMALLOC
MANCINIMARISAGEYERMHDVANDERWIEL
MICHILLIMOSSMSERYLAK
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRADFRANK
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HARWOODHMULDERHOLTIES
IACOBELLIJANRINZEJHARWOOD
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMORGANTI
MOSSNYLANDPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

LOTAAS: The LOFAR Tied-Array All-Sky Survey for Pulsars and Fast Transients

A search for radio emission from exoplanets around cool evolved stars

Energetic electron production in solar flares

Characterizing the Low-Frequency Emission Properties of FRB

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISWIGGUMJTORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE

Interferometric imaging observations of the Sun with LOFAR

Detection of the extended disk of the nearly face-on galaxy NGC628

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

HBA observations of the remarkable radio source in Abell 2626

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISSTRAAL
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Stellar Radio Astronomy with LOFAR

Deep Observation of Pulsar Wind Nebula 3C 58

Searching for MHz emission from brown dwarfs

ALWINANTONIARARNOSCHOENMAKERS
ASTEWARTAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DARIOCARBONEDONKEREORRU
FENDERFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJBRODERICKJDSWINBANK
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISWINBANKTORIBIO
VEENVERMAASYCENDES
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

First detection of brown dwarfs with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

The Low-Frequency Profile of the Recycled High-Energy Pulsar J1614-2318

A Full Census of the Known Pulsar Population: Extension to the Lowest Radio Frequencies

LOTAAS: The LOFAR Tied-Array All-Sky Survey for Pulsars and Fast Semester : LOFAR_LT_C2 Transients

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Detecting a Nuclear Bubble in a Face-on Spiral Galaxy

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Searching for Jet Relics and Radio Supernovae in M51 with LOFAR Long Baselines

Studying the local interstellar medium

Search of radio emission from the 55 Cnc exoplanetary system

Imaging of the Moon

ALWINARCHIBALDARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECSOBEY
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MARIOMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Multifrequency study of a newly discovered double-double source J0028+0035

Study of the evolution of compact radio sources

Blazar-Jet Kinetic Power from Low-Frequency Radio Observations

Monitoring of the Crab pulsar

Observing the Interplanetary Magnetic Field with LOFAR

A 135-MHz LOFAR Survey for Millisecond Pulsars in Unidentified Fermi-LAT Gamma-Ray Sources

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Interferometric Observations of the Active Regions in Radio Domain Before and After the Total Solar Eclipse on 21 August 2017

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BWSCERRIGONECOOPER
DONKEREORRUFRIESWIJK
GOEIHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMEVIUSMHDVANDERWIEL
MOSSNOORDAMPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Probing the Cold Interstellar Medium in the Milky Way.

M33

The polarization footprint of a nearby anomalously turbulent scattering screen

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBOTTEON
BRENTJENSCERRIGONEDONKER
EORRUFDGFEDERICASAVINI
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASVIRGINIA_77
WISEYGRANGEZIEMKE
ZUCCAP

PAVING THE WAY TO THE SEARCH FOR ULTRA-STEEP SPECTRUM RADIO HALOS

ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHYZYDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESHORNEFFER
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Quantitative diagnostics of electron beams in the solar corona

Cobalt_Delays

ALWINANOUTSOSARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRETONRBWS
CBASSACERRIGONECHIATAN
COOPERCSOBEYDONKER
EORRUFRIESWIJKGOEI
GRIESSMEIERHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JDONNERJJDMOLJKUENSEM
JORISVERBIESTJURGESKLAZEMA
KLIJNMALLOCMANCINI
MARISAGEYERMHDVANDERWIELMICHILLI
MOSSMSERYLAKPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SOSLTORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZPLEUNISZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Magnetizing the universe with starbursting dwarf galaxies

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDIANAMOROSAN
DONKEREDUARDEORRU
FKBREITLFRIESWIJKGMANN
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARIOMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
AWTIER0

Rollout June 2017 test making project

Supplementary observation of Saturns deep atmosphere with LOFAR for the determination of the abundance of water

150 MHz continuum emission from quasar host galaxies at z > 5

LOFAR Epoch of Reionization observations on the 7 NCP fields: On A Fast Track to the EoR/Cosmic Dawn

Determining the origin and (magnetic) substructure of the Fermi bubbles

A Full Census of the Known Pulsar Population: Expanding Sky Coverage

The properties of the slowest spinning radio pulsar

Pulsars

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGCIMOGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARIO
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JCALJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMAMTAPOMMIERMANCINI
MCKEANMHAJDUKMHDVANDERWIEL
MORABITOMOSSNJJ
PHILIPPAHARTLEYPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVARENIUSVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

The curious case of HCG15: a little cousin of the Coma cluster?

Low frequency study of J1740 using the interferometric imaging method

Local Enhancements of Cluster B field due to Interaction with Embedded Radio Galaxies

Using Diffractive Interstellar Scintillations (DISS) to Resolve Pulsar magnetospheres and the issue of potential DC emission

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

The LOFAR EoR project

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CAROCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MAGDAMALLOCMANCINI
MHDVANDERWIELMOSSOLW
PIZZORAF93RBOKHORST
RENTINGROTTGERINGSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

The Magnetic Fields and Pulsar Spectra in Globular Clusters

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Observations of solar type II radio bursts by LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMORABITO
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMBRUEGGEN
MHDVANDERWIELMKADLERMOSS
PIZZORAF93RBOKHORST
RENTINGRSCHULZSARRVESH
SCHAAPSHULEVSKITORIBIO
TRUESTEDTVEENVERMAAS
YGRANGEZIEMKEZUCCAP

All public data for all instruments

AWTIER0

Approved commissioning projects

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FREYFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
IVBEMMELJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNLGURVITSMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGROONKRVWEEREN
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZPARAGI
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSANIDAS
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZPLEUNIS
ZUCCAP

First detailed study of a gamma-ray binary outburst at 150 MHz and search for extended emission

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMARIOMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JEISLOEFFELJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MHOEFTMOSSPIZZO
RAF93RAINSWORTHRBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASWUCKNITZYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MICHAELJOHNSONMJJOHNSONMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINANOUTSOSARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
CHIATANCOOPERCSOBEY
DONKEREORRUFRIESWIJK
GOEIHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JDONNERJJDMOLJKUENSEM
JORISVERBIESTJURGESKLAZEMA
KLIJNMALLOCMANCINI
MARISAGEYERMHDVANDERWIELMICHILLI
MOSSMSERYLAKPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SOSLOWSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP

Radio Structures in a Newly-Discovered Early-Stage Major Merger

ALWINARNOSCHOENMAKERSASTEWART
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJBRODERICKJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Probing the Galactic Interstellar Medium on Unprecedented Scales

Mapping the kpc-scale structure of Compact Steep Spectrum sources at 150 MHz

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKERDR2207
EORRUFANXIAOHUIFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
RWANGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASWAGGYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BDABROWSKIBEUKEMABLAAUW
BRENTJENSCERRIGONECVOCKS
DONKEREDUARDEORRU
FKBREITLFRIESWIJKGALLAGPT
GDELZANNAGMANNGOEI
HAMISHREIDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNKRANKOSKIMALLOC
MANCINIMARQUEMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARGAM
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
AWTIER0

The Three Low-Frequency Drift Modes in the Harmonic Pulsar

Long-term proposal for solar observations with LOFAR - additional observations

LOFAR Survey of nearby galaxies

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONECHIATAN
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SANIDASSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Additional Timing Observations on LOTAAS Pulsar Discoveries

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0

LOFAR Observation of Eclipsing Binary Pulsars

Search for variable radio emissions from the V830 Tau system over the range 110-190 MHz

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDIANAMOROSAN
DONKEREDUARDEORRU
FKBREITLFRIESWIJKGMANN
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARIOMARQUE
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Cold Fronts, Large Scale Sloshing, and Mpc-scale Particle Acceleration

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKERDRABENT
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJCONWAYJJDMOL
JKUENSEMJMOLDONJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
NJJPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

2015LOFAROBS

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BWSCBASSACERRIGONE
CHIATANCOOPERDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJOERIJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMICHILLI
MOSSPIZZORAF93
RBOKHORSTRENTINGSANIDAS
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP
AWTIER0

Following up the first ever detected accretion burst in a high-mass YSO

LOBOS: the LOFAR LOng-Baseline calibratOr Survey - II

ADELLERALBERTALWIN
ANTONIARAPMECHEVARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRUNETTI71CERRIGONE
CHYZYCTASSEDONKER
DRABENTEBONNASSIEUXEORRU
FDGFRIESWIJKGLENNWHITE
GOEIHALEHAVERKORN
HMULDERHOANGHOLTIES
IACOBELLIJANRINZEJCONWAY
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMATTHEWLEHNERTMHDVANDERWIEL
MHOEFTMJHMORABITO
MORGANTIMOSSNJJ
PIZZOPNBESTRAF93
RAFFERTYRBOKHORSTRENTING
ROONKRVWEERENSARRVESH
SCHAAPSHIMWELLSHULEVSKI
STEPHEN_BOURKETORIBIOVEEN
VERMAASWILLIAMSWISE
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRAMSAY
HMULDERHOLTIESIACOBELLI
JANRINZEJEENRIQUEZJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNKUZNETSOV2015MALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZARKA
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HARISHHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECSOBEYDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJSMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGRVWEERENSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONECSOBEY
DONKEREORRUFRIESWIJK
GEMMAGOEIGOLAM
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JORISVERBIESTJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SOSLTORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Intergalactic Magnetic Fields in Galaxy Systems - Close Pair NGC4490/85

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRETONRCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JORISVERBIESTJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Cosmic ray propagation in two nearby spiral galaxies

Commissioning2015

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABIRZANBLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGLENNWHITE
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAHONYMALLOC
MANCINIMHDVANDERWIELMJH
MOSSPIZZOPNBEST
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONEDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SANIDASSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZPLEUNISZUCCAP
AWTIER0

Cygnus X-1 in the hard state: the low radio frequency follow-up

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

The physical conditions of the cold neutral medium on 10' scales

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINAMRUTAARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
CHIATANCOOPERDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJOERIJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMICHILLI
MOSSPIZZORAF93
RBOKHORSTRENTINGSANIDAS
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP

Additional Timing Observations on LOTAAS Pulsar Discoveries

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSASTEWART
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJBRODERICKJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RAFFERTYRBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOANGHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMBRUEGGEN
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGER
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJCAL
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMORGANTI
MOSSNJJPIZZO
RAF93RBOKHORSTRENTING
RSCHULZSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Discovering the warm-hot intergalactic medium in filaments with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMATTJARVIS1MHDVANDERWIEL
MORABITOMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASWILLIAMSYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITOBIACTORIBIO
VEENVERMAASWUCKNITZ
YGRANGEZIEMKEZUCCAP

The LOFAR LBA Exploratory Survey

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
OLAFSCHOLTENPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSASCAIFE
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MASHAMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BAPTISTECECCONIBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
DSANTOSCOSTAEORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIIMKEDEPATERJANRINZE
JJDMOLJKUENSEMJULIENGIRARD
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MICHILLIMOSSPIZZO
RAF93RBOKHORSTRENTING
RFENDERRSAULTSARRVESH
SCHAAPSEB_HESSSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZARKAZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CCOUGHLANCERRIGONEDONKER
DRABENTEORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJEISLOEFFEL
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMHOEFT
MOSSPIZZORAF93
RAINSWORTHRBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TOMRAYTORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFRIESWIJKGMANN
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MARIOMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Low-frequency radio emission from X-ray binaries

ALWINARNOSCHOENMAKERSASTEWART
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
DONKEREORRUFENDER
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JBRODERICKJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASWIJERS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDCSEHDONKER
EORRUFRIESWIJKGOEI
GRAMSAYHMULDERHOLTIES
IACOBELLIJANRINZEJEENRIQUEZ
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZARKA
ZIEMKEZUCCAP

Gravitational lenses at low frequencies

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Exploring Merger-Induced Diffuse Radio Emissions in Groups of Galaxies

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGROONKSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ABILOUSALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
GWRIGHTHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJOERIJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISMITSTORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

A LOFAR survey for millisecond pulsars in unidentified Fermi gamma-ray sources

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Commissioning observations 2017

A low frequency study of a new sample of double-double radio galaxies

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

All users

LOTAAS: The LOFAR Tied-Array All-Sky Survey for Pulsars and Fast Transients

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESIACOBELLI
IHOFFMANJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
ROONKSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CBASSACERRIGONEDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SANIDASSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZPLEUNISZUCCAP

COBALT

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVARENIUS
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FREYFRIESWIJKGABANYIK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNLGURVITSMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGROONKRVWEEREN
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
AWTIER0

The LOFAR Galactic Plane RRL Survey: the inner Galactic plane

Pulsar timing with LOFAR

LC0_003

Monitoring Scintillation above LOFAR

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Atomic hydrogen at z>5

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGEMMAGOEI
GOLAMHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MARIOMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Triggered follow-up for AARTFAAC Transient Sources

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGLENNWHITEGOEI
HAVERKORNHESSELSHMULDER
HOLTIESIACOBELLIJACCOVINK
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARIAARIASDESAA
MHDVANDERWIELMOSSPIZZO
PSALASRAF93RBOKHORST
RENTINGROONKSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASWREICH
YGRANGEZIEMKEZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

LOFAR Observation of the Passage of a Coronal Mass Ejection

ADELLERALWINARNOSCHOENMAKERS
ASTROEAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREORRUFRIESWIJK
GATISGGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JHARWOODJJDMOLJKUENSEM
JMOLDONJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMORGANTIMOSS
NJJPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VAVILINAVEENVERMAAS
YGRANGEZIEMKEZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHYZYDMULCAHY
DONKEREAKADAMSEORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESHORELLOU
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RAINER_BECKRBOKHORST
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASVHEESEN
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKIMZAGKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPILIA
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP

Long Baseline Studies of High-Redshift Radio Sources: Constraining particle acceleration and cold gas

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Calibration and Imaging Tiger Team

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMORABITO
MOSSPIZZOPSALAS
RAF93RBOKHORSTRENTING
ROONKROTTGERINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDANIELWDONKER
EORRUFRIESWIJKGOEI
GRIESSMEIERHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMKNAPPMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASWMAJIDYGRANGE
ZIEMKEZUCCAP

Fly's eye monitoring observations

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGLENNWHITEGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
PSALASRAF93RBOKHORST
RENTINGROONKROTTGERING
SARRVESHSCHAAPSHULEVSKI
TIELENSTORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ABONAFEDEALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFEDEGOVONIFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMMURGIAMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVVACCAYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Targeted Pulsar Searches toward Globular Clusters and Isolated Neutron Stars

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
DRABENTEORRUFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJCONWAY
JJDMOLJKUENSEMJMOLDON
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSNJJPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TAGOREASTORIBIOVARENIUS
VEENVERMAASWUCKNITZ
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Rapid follow-up of Short Gamma-Ray Bursts

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FARNSWORTHFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGRVWEEREN
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

The Evolutionary Impact of Radio Lobes in a Nearby Early-Type Galaxy: A Low-Frequency Case Study of NGC3998

Pulsar Timing with LOFAR

Exploitation of LOFAR surveys to study galaxy clusters

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR Commissioning 2013

Pulsar Timing with LOFAR

Commissioning2014

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

FRATs: Commensal Real-Time Searches and localization of Fast Radio Bursts

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSARP
ASCAIFEAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
CHYZYDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARITA
MHDVANDERWIELMOSSPIZZO
RAF93RAINER_BECKRBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

LOFAR surveys: Opening up a new window on the Universe

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMCROSLE1MHDVANDERWIEL
MOSSOSTENPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Extragalactic Radio Recombination Lines: An LTA resource project.

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Cosmic ray propagation in NGC 5033

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREBRINKS
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
LUKEMALLOCMANCINI
MHDVANDERWIELMJHMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASVHEESEN
WILLIAMSYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFKBREITLFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMAGDALENICMALLOC
MANCINIMARQUEMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE
ALBERTALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRUNETTI71CERRIGONE
CHYZYDONKEREMIG
EORRUFDGFRIESWIJK
GLENNWHITEGOEIHAVERKORN
HMULDERHOLTIESHUIBINTEMA
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MATTHEWLEHNERTMHDVANDERWIELMORABITO
MORGANTIMOSSPIZZO
RAF93RBOKHORSTRENTING
ROTTGERINGRVWEERENSARRVESH
SCHAAPSHIMWELLSHULEVSKI
SMANDALTORIBIOVEEN
VERMAASWILLIAMSWISE
YGRANGEZIEMKEZUCCAP

LOFAR Observations of Jupiters Synchrotron Radiation

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFKBREITLFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Monitoring Continuum and Beamformed Pulsar Flux Density

Probing pulsar magnetospheres at 10-90 MHz with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0

Stephan's Quintet: the role of shocks in the formation of the hot intragroup medium

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGEMMAGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJOERIJURGES
KLAZEMAKLIJNMALLOC
MALLORYRMANCINIMHDVANDERWIEL
MIXKLIMMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSASTROJAKE
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
GRIESSMEIERHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJULIENGIRARDJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOTURNER
VEENVERMAASWMAJID
YGRANGEZARKAZIEMKE
ZUCCAP

Pulsar VLBI for precision pulsar scintellation astrometry

Imaging compact SNR, Supernova and AGN emission in M82 and M81

A SYSTEMATIC SEARCH OF THE 10 NEAREST STARS FOR PLANETARY MAGNETOSPHERE EMISSIONS

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKERECARLEY
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

A SYSTEMATIC SEARCH OF THE 10 NEAREST STARS FOR PLANETARY MAGNETOSPHERE EMISSIONS (a continuation from Cycle 4)

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHEALD
HMULDERHOLTIESHORNEFFER
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Free-free absorption by cool ionized gas in two nearby galaxies

A detailed study of AGN physics and feedback with Cygnus A

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ADELLERALWINANDREWSIEMION
ARNOSCHOENMAKERSAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DCSEHDMULCAHYDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
HORNEFFERIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMICHILLI
MOSSPIZZORAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
WUCKNITZYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOTRUESTEDT
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

The 2015 V404 Cyg outburst: detecting radio oscillations with LOFAR

Probing Extragalactic Sources via Carbon Radio Recombination Lines

AWTIER0
ADEBAHRALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESHORNEFFER
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0

Using LOFAR for detailed studies of AGN, and AGN physics

Solar imaging and dynamic spectrum

Wide-field searches for image-plane radio transients

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDMULCAHYDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESHORNEFFER
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

The flux density scale between 30 and 500 MHz

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINAMARECKIARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JAMROZYJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPAJDOSZ
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

The project for storing the HTTP requests

ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGER
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNLVEKOOPMANSMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSALEEMSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Long Baseline Studies of High-redshift Radio Sources: Constraining particle acceleration and cold gas

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Extended radio continuum halos in the edge-on galaxies NGC3432 and NGC5907

LOFAR Survey of High Mass star forming regions in Galactic Plane - The Orion Nebula

Wide-field searches for image-plane radio transients

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHYZYDMULCAHY
DONKEREORRUFRIESWIJK
GOEIHMULDERHOLTIES
HORNEFFERIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNKLKLEIN
KSENDMALLOCMANCINI
MHDVANDERWIELMIDDELBERGMOSS
PIZZORAF93RAINER_BECK
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
UKLEINVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

The LBA and HBA studies of Cosmic Ray propagation in NGC6946

A determination of the abundance of water in Saturn's deep atmosphere with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Disentangling the central kpc of the Medusa merger

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Investigating the peculiar nature of mixed morphology supernova remnants: W63 and HB9

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALBERTALWINARNOSCHOENMAKERS
AWTIER0BCJBEUKEMA
BLAAUWBRENTJENSBRUNETTI71
CERRIGONECHYZYCTASSE
DONKEREORRUFDG
FRIESWIJKGLENNWHITEGOEI
HMULDERHOANGHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMJHMORGANTI
MOSSNJJPIZZO
RAF93RAFFERTYRBOKHORST
RENTINGRVWEERENSARRVESH
SCHAAPSHIMWELLSHULEVSKI
TORIBIOVEENVERMAAS
WISEYGRANGEZIEMKE
ZUCCAP

Monitoring Ionospheric Scintillation above LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNLGURVITS2
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

LOFAR studies of pulsars, fast transients and the interstellar medium

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGER
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKHAN
KLAZEMAKLIJNLVEKOOPMANS
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSAROD
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VJELICYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE

Study of atomic hydrogen at z>5

LOFAR surveys: Opening up a new window on the Universe

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ABILOUSALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBWSCERRIGONE
DONKEREORRUFRIESWIJK
GOEIHESSELSHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMICHILLI
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AARCHIBAALWINARNOSCHOENMAKERS
ASEYMOURAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
DONKEREFONSECAEORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KARAKOCKIMZAGKLAZEMA
KLIJNLLEVINMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISRANSOMTORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MKUIACKMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

Recovering intermediate-scale, diffuse Galactic recombination lines

ALBERTALWINANTONIAR
ARNOSCHOENMAKERSAWTIER0BEUKEMA
BLAAUWBRENTJENSBRUNETTI71
CERRIGONECHYZYCTASSE
DONKERDRABENTEBONNASSIEUX
EORRUFDGFRIESWIJK
GLENNWHITEGOEIHAVERKORN
HMULDERHOANGHOLTIES
IACOBELLIJANRINZEJCONWAY
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMATTHEWLEHNERTMATTJARVIS1
MHDVANDERWIELMJHMORGANTI
MOSSNJJPIZZO
RAF93RAFFERTYRBOKHORST
RENTINGROONKRVWEEREN
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASWILLIAMSYGRANGE
ZIEMKEZUCCAP
AWTIER0

Directors Discretionary time - Radio Recombination Lines Cas A

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECTASSEDONKER
EORRUFRIESWIJKGOEI
GRIESSMEIERHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJULIENGIRARDJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
NOISYSKYPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISOOBASH
TORIBIOVEENVERMAAS
YGRANGEZARKAZIEMKE
ZUCCAP
AWTIER0
ADEBAHRALWINANDREWFLETCHER
ARNOSCHOENMAKERSAWTIER0BEUKEMA
BLAAUWBRENTJENSCERRIGONE
CHYZYDMULCAHYDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
HORELLOUHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
KSENDMALLOCMANCINI
MHDVANDERWIELMORABITOMOSS
PIZZORAF93RAINER_BECK
RBOKHORSTRENTINGRGIES
ROONKSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BCJBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKKMAKLAZEMA
KLIJNMALLOCMANCINI
MANOMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEYMAAN4
ZIEMKEZUCCAP

Pulsar VLBI observations

Coronal mass ejections and type II radio bursts

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABIAGIOFORTEBLAAUW
BRENTJENSCERRIGONECVOCKS
DONKEREORRUFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMARIOMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ADEBAHRALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECHYZY
DONKEREORRUFABIENBATEJAT
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIIVANMARTIVIDAL
JANRINZEJCONWAYJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBESWICKRBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVARENIUS
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Radio observations of the planetary system Upsilon Andromedae

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
ROTTGERINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECLARKEDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRETONRCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJORISVERBIESTJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPOLZINRAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JEGPEEKJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGROONK
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP

LONG BASELINE STUDIES OF HIGH-REDSHIFT RADIO SOURCES: Constraining particle acceleration and cold gas

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
ROTTGERINGSARRVESHSCHAAP
SHULEVSKITIELENSTORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Investigating the peculiar nature of mixed morphology supernova remnants: VRO 42.05.01 and W63

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Imaging of extended emission in the Galactic plane

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDIANAMOROSAN
DONKEREDUARDEORRU
FRIESWIJKGMANNGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MAGDALENICMALLOCMANCINI
MARIOMARQUEMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

Duty cycle of the active galactic nuclei: deep low-frequency observations of the blazar SBS B1646+499

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECHYZYDONKER
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
HORELLOUIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOV301URB
VEENVERMAASWARWAS
YGRANGEZIEMKEZUCCAP
ALWINANOUTSOSARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSOULYANOVPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
VLADYERIN_SERGEYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOTAAS: The LOFAR Tied-Array All-Sky Survey for Pulsars and Fast Transients

The LOFAR Two-metre Sky Survey: Opening up a new window on the Universe

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISSTRAAL
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
AAYUSHSAXENAADELLERADRABENT
ALBERTALWINANTONIAR
APMECHEVARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRUNETTI71CERRIGONEDONKER
EORRUFDGFRIESWIJK
GOEIHAVERKORNHMULDER
HOANGHOLTIESHUIBINTEMA
IACOBELLIJANRINZEJJDMOL
JKUENSEMJSMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMATTHEWLEHNERTMBRUEGGEN
MHDVANDERWIELMHOEFTMJH
MORABITOMOSSNJJ
NJJ1NYLANDPIZZO
PNBESTRAF93RAFFERTY
RBOKHORSTRENTINGROTTGERING
RVWEERENSARRVESHSCHAAP
SHIMWELLSHULEVSKISMANDAL
STEPHEN_BOURKETORIBIOVEEN
VERMAASVIKRAMRADHAKRISHNANWILLIAMS
WISEYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
NJJ1PIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Lunar occultation: Towards measurement of the global redshifted 21- cm signal from cosmic dawn

The First LOFAR Observations of a Complete Sample of Revived Fossil Plasma Sources

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

The Physics of Neutron Star Formation and Particle Creation and Acceleration in PWN G54.1+0.3

ALWINANDREWSIEMIONARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJEENRIQUEZJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
SIEMIONTORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0

The Unexplained Pressure in the Closest Cold ISM

ALWINARNOSCHOENMAKERSASCAIFE
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECLARKE
DMULCAHYDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMITSUISHIIKUYUKI
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECVOCKSDONKER
EORRUFKBREITLFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMARIOMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREFONSECA
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKARAKOC
KIMZAGKLAZEMAKLIJN
LLEVINMALLOCMANCINI
MHDVANDERWIELMOSSPILIA
PIZZORAF93RBOKHORST
RENTINGRLYNCHSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVLAD
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISOOBASHTORIBIO
VEENVERMAASYGRANGE
ZARKAZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJOERI
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYCENDES
YGRANGEZIEMKEZUCCAP

LOFAR blank-field surveys: AGN, star-formation and cosmology

Director Discretionary Time - GNSS tracking

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGRIESSMEIER
HFALCKEHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
WMAJIDYGRANGEZARKA
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Gravitational lenses at low frequencies

ABONAFEDEALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECHIARA082075
DONKEREORRUFEDEGOVONI
FRIESWIJKGGIOVANNGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JULIENGIRARDJURGESKLAZEMA
KLIJNLFERETTIMALLOC
MANCINIMATTEO_MURGIAMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVVACCA
YGRANGEZIEMKEZUCCAP
ALBERTALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRUNETTI71CERRIGONE
CHYZYDONKEREMIG
EORRUFDGFRIESWIJK
GLENNWHITEGOEIHAVERKORN
HMULDERHOLTIESHUIBINTEMA
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MATTHEWLEHNERTMBRUEGGENMHDVANDERWIEL
MJHMORABITOMORGANTI
MOSSNJJPIZZO
PNBESTRAF93RBOKHORST
RENTINGROONKROTTGERING
RVWEERENSARRVESHSCHAAP
SHIMWELLSHULEVSKISMANDAL
TORIBIOVEENVERMAAS
WILLIAMSYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FDGFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJCROSTONJHARWOOD
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMJH
MORABITOMOSSNJJ
PIZZORAF93RBOKHORST
RENTINGRVWEERENSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Lunar occultation of the cosmic radio background

A Full Census of the Known Pulsar Population at LOFAR Frequencies

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZOPSALASRAF93
RBOKHORSTRENTINGROONK
ROTTGERINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP

Measuring the energy of Saturn's lightning

ADEBAHRALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECHYZY
DMULCAHYDONKEREBRINKS
EORRUFRIESWIJKGOEI
HEALDHMULDERHOLTIES
HORELLOUIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNKSEND
LUKEMALLOCMANCINI
MARITAKRAMHDVANDERWIELMOSS
PALADINOPIZZORAF93
RAINER_BECKRBOKHORSTRENTING
RJDETTMARSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASVHEESEN
WARWASYGRANGEZIEMKE
ZUCCAP

2015LOFAROBS

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

All users

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR study of Jupiter's radiation belts physics coordinated with remote sensing and in-situ Juno observations

AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BWSCERRIGONECHIATAN
COOPERCSOBEYDONKER
EORRUFRIESWIJKGOEI
HESSELSHMULDERHOLTIES
IACOBELLIJANRINZEJDONNER
JJDMOLJKUENSEMJOERI
JORISVERBIESTJURGESKIMZAG
KLAZEMAKLIJNMALLOC
MANCINIMARISAGEYERMHDVANDERWIEL
MICHILLIMOSSMSERYLAK
PILIAPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISOSL
SOSLOWSKITORIBIOVEEN
VERMAASVLADYGRANGE
ZIEMKEZUCCAP

STUDY OF NON-MERGING MASSIVE CLUSTERS AT LOW FREQUENCY

ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGER
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJPMACQUARTJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSASCAIFE
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECHYZY
DONKEREORRUFRIESWIJK
GOEIHEALDHMULDER
HOLTIESHORNEFFERIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESJURUSIKKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMORABITOMOSS
NALAPIZZORAF93
RAINER_BECKRBOKHORSTRENTING
ROBERTDRZAZGAROONKSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINANOUTSOSARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRETONRBWS
CERRIGONECHIATANCOOPER
DONKEREORRUFRIESWIJK
GOEIGRIESSMEIERHMULDER
HOLTIESIACOBELLIJANRINZE
JDONNERJJDMOLJKUENSEM
JORISVERBIESTJURGESKLAZEMA
KLIJNMALLOCMANCINI
MARISAGEYERMHDVANDERWIELMICHILLI
MOSSMSERYLAKPIZZO
POLZINRAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKISOSLSOSLOWSKI
TORIBIOVEENVERMAAS
VLADYGRANGEZIEMKE
ZUCCAP
ALBERTALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSBRUNETTI71CERRIGONE
CHYZYDONKEREMIG
EORRUFDGFRIESWIJK
GLENNWHITEGOEIHAVERKORN
HMULDERHOLTIESHUIBINTEMA
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MATTHEWLEHNERTMHDVANDERWIELMJH
MORABITOMORGANTIMOSS
NJJPIZZORAF93
RBOKHORSTRENTINGROONK
RVWEERENSARRVESHSCHAAP
SHIMWELLSHULEVSKITORIBIO
VEENVERMAASWILLIAMS
WISEYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AAYUSHSAXENAADELLERADRABENT
ALBERTALWINANTONIAR
APMECHEVARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRUNETTI71CERRIGONECHYZY
CTASSEDONKEREDWIN128
EORRUFDGFRIESWIJK
GOEIHAVERKORNHMULDER
HOANGHOLTIESHUIBINTEMA
IACOBELLIJANRINZEJCONWAY
JJDMOLJKUENSEMJSM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMATTHEWLEHNERT
MBRUEGGENMHDVANDERWIELMHOEFT
MILEYMJHMORABITO
MORGANTIMOSSNJJ
NYLANDPIZZOPNBEST
RAF93RAFFERTYRBOKHORST
RENTINGROONKRVWEEREN
SARRVESHSCHAAPSHIMWELL
SHULEVSKISMANDALSTEPHEN_BOURKE
TORIBIOVEENVERMAAS
WILLIAMSYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JCROSTONJHARWOODJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMJHMORGANTI
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASVHEESEN
YGRANGEZIEMKEZUCCAP

Interplanetary Scintillation Observations

commissioning projects 2016

ALBERTALWINARNOSCHOENMAKERS
ASCAIFEAWTIER0BCJ
BEUKEMABLAAUWBRENTJENS
CERRIGONECHYZYDMULCAHY
DONKEREORRUFRIESWIJK
GOEIHAVERKORNHEALD
HMULDERHOLTIESHORELLOU
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMORABITOMOSS
PIZZOPNBESTRAF93
RAINER_BECKRBOKHORSTRENTING
ROHINIJOSHISARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASVVACCAYGRANGE
ZIEMKEZUCCAP

The LOFAR EoR project

MSSS_LBA

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREMIG
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZOPSALAS
RAF93RBOKHORSTRENTING
ROTTGERINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDANIELWDONKER
EORRUFRIESWIJKGOEI
GRIESSMEIERHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMKNAPPMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASWMAJIDYGRANGE
ZARKAZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONECORBELDONKER
EORRUFENDERFRIESWIJK
GOEIHMULDERHOLTIES
IACOBELLIJANRINZEJBRODERICK
JCAMJJJDMOLJKUENSEM
JURGESKLAZEMAKLIJN
MALLOCMANCINIMHDVANDERWIEL
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP

ISM Properties and Recurrent Nuclear Activity in Nearby Luminous Galaxy Mergers

NGC3079 observations of starburst disk and outflow

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHAVERKORN
HMULDERHOLTIESIACOBELLI
IPOLDERMANJACCOVINKJANRINZE
JJDMOLJKUENSEMJONGREGSON
JURGESKLAZEMAKLIJN
MALLOCMANCINIMARIAARIASDESAA
MHDVANDERWIELMOSSPIZZO
PSALASRAF93RBOKHORST
RENTINGROONKSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSASTROJAKE
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
GRIESSMEIERHMULDERHOLTIES
IACOBELLIIVASYLIEVAJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNLECAVELI
LLAMYMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTREJUVA1
RENTINGRIABOVSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMOSS
OLAFSCHOLTENPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SBUITINKSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGOEIGREGGHALLINAN
GUEDELMHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MCROSLE1MHDVANDERWIELMOSS
OSTENPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKISLH
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

LOFAR surveys of galaxy clusters

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKGERGOEI
HARISHHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
AWTIER0HTTP_OPERSCHAAP
YGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BDABROWSKIBEUKEMABLAAUW
BRENTJENSCERRIGONECVOCKS
DONKEREORRUFRIESWIJK
GMANNGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KACPERKOTULAKKLAZEMAKLIJN
LESZEK_BLASZKIEWICZMALLOCMANCINI
MHAJDUKMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEYOSS
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0
ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMKLAZEMA
KLIJNMALLOCMHDVANDERWIEL
PIZZORAF93RBOKHORST
RENTINGSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGE
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Exploring Merger-Induced Diffuse Radio Emission in Groups of Galaxies

ALWINANTONIARARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER
EORRUFRIESWIJKGOEI
HMULDERHOLTIESIACOBELLI
JANRINZEJBRODERICKJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNMALLOCMANCINI
MHDVANDERWIELMOSSPIZZO
RAF93RBOKHORSTRENTING
SARRVESHSCHAAPSHULEVSKI
TORIBIOVEENVERMAAS
YGRANGEZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSASCAIFE
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONECLARKE
DMULCAHYDONKEREORRU
FRIESWIJKGOEIHMULDER
HOLTIESIACOBELLIJANRINZE
JJDMOLJKUENSEMJURGES
KLAZEMAKLIJNMALLOC
MANCINIMHDVANDERWIELMITSUISHIIKUYUKI
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
ZIEMKEZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BDABROWSKIBEUKEMABLAAUW
BRENTJENSCERRIGONECVOCKS
DONKEREDUARDEORRU
FRIESWIJKGMANNGOEI
HAMISHREIDHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMJURGESKLAZEMA
KLIJNKRANKOWSKIMAGDALENIC
MALLOCMANCINIMARIO
MARQUEMHDVANDERWIELMOSS
PIZZORAF93RBOKHORST
RENTINGSARRVESHSCHAAP
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
AWTIER0

Magnetic Fields and Cosmic-ray Propagation in M31

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE
AWTIER0

Coronal density studies with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Magnetisation of the universe - the LBA studies of NGC 4449

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Pulsar Scattering Analysis with LOFAR HBA band 5 and 7

ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
CERRIGONEDONKEREORRU
FRIESWIJKHMULDERHOLTIES
IACOBELLIJANRINZEJJDMOL
JKUENSEMKLAZEMAKLIJN
MALLOCMHDVANDERWIELPIZZO
RAF93RBOKHORSTRENTING
SCHAAPSHULEVSKITORIBIO
VEENVERMAASYGRANGE

Magnetisation of the Universe - the case of the starbursting irregular galaxy NGC 4449

ADELLERALWINARNOSCHOENMAKERS
AWTIER0BEUKEMABLAAUW
BRENTJENSCERRIGONEDMULCAHY
DONKEREORRUFDG
FRIESWIJKGOEIHEALD
HMULDERHOANGHOLTIES
HOUBENIACOBELLIJANRINZE
JJDMOLJKUENSEMJMOLDON
JPRACHENJURGESKLAZEMA
KLIJNMALLOCMANCINI
MARIAARIASDESAAMHDVANDERWIELMORABITO
MOSSPIZZORAF93
RBOKHORSTRENTINGSARRVESH
SCHAAPSHANSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASYGRANGEZIEMKE
ZUCCAP
ALWINARNOSCHOENMAKERSAWTIER0
BEUKEMABLAAUWBRENTJENS
BRUNETTI71CERRIGONECHYZY
CTASSEDONKERDSMITH
EORRUFDGFRIESWIJK
GLENNWHITEGOEIHAVERKORN
HEALDHMULDERHOLTIES
HUIBINTEMAIACOBELLIJANRINZE
JCROSTON2JJDMOLJKUENSEM
JURGESKJDUNCANKLAZEMA
KLIJNMALLOCMANCINI
MATTHEWLEHNERTMBRUEGGENMCKEAN
MHDVANDERWIELMJHMORABITO
MORGANTIMOSSNJJ
PIZZORAF93RBOKHORST
RENTINGROTTGERINGRVWEEREN
SARRVESHSCHAAPSHIMWELL
SHULEVSKITORIBIOVEEN
VERMAASWILLIAMSYGRANGE
ZIEMKEZUCCAP

Interferometric imaging observations of the Sun with LOFAR

ALWINARNOSCHOENMAKERSAWTIER0
AWTIER2EORBEUKEMABLAAUW
BRENTJENSCERRIGONEDONKER</